Placeholder image of a protein
Icon representing a puzzle

1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Gargleblasters 100 pts. 8,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 8,383
  3. Avatar for Go Science 3. Go Science 63 pts. 8,365
  4. Avatar for Contenders 4. Contenders 49 pts. 8,361
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 8,361
  6. Avatar for Beta Folders 6. Beta Folders 28 pts. 8,332
  7. Avatar for Deleted group 7. Deleted group pts. 8,325
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 8,318
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,291
  10. Avatar for freefolder 10. freefolder 8 pts. 8,237

  1. Avatar for PrettyPony2001 141. PrettyPony2001 Lv 1 2 pts. 7,754
  2. Avatar for Colostomy EXPLOSION. 142. Colostomy EXPLOSION. Lv 1 2 pts. 7,754
  3. Avatar for Pro Lapser 143. Pro Lapser Lv 1 2 pts. 7,754
  4. Avatar for smholst 144. smholst Lv 1 2 pts. 7,751
  5. Avatar for foldit@bechan 145. foldit@bechan Lv 1 1 pt. 7,747
  6. Avatar for Inkedhands 146. Inkedhands Lv 1 1 pt. 7,742
  7. Avatar for Mohambone 147. Mohambone Lv 1 1 pt. 7,738
  8. Avatar for brgreening 148. brgreening Lv 1 1 pt. 7,721
  9. Avatar for mirjamvandelft 149. mirjamvandelft Lv 1 1 pt. 7,711
  10. Avatar for Ellis Shih 150. Ellis Shih Lv 1 1 pt. 7,702

Comments