1127: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 10 years ago

Summary

• Created: August 18, 2015
• Expires: August 25, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

• 1. Gargleblasters 100 pts. 8,384
• 2. Anthropic Dreams 80 pts. 8,383
• 3. Go Science 63 pts. 8,365
• 4. Contenders 49 pts. 8,361
• 5. HMT heritage 37 pts. 8,361
• 6. Beta Folders 28 pts. 8,332
• 7. Deleted group pts. 8,325
• 8. Void Crushers 15 pts. 8,318
• 9. L'Alliance Francophone 11 pts. 8,291
• 10. freefolder 8 pts. 8,237

Top soloists

• 111. goldfish80 5 pts. 7,940
• 112. dettingen 5 pts. 7,930
• 113. proteansoup 5 pts. 7,926
• 114. pfeiffelfloyd 4 pts. 7,919
• 115. Glen B 4 pts. 7,916
• 116. JUMELLE54 4 pts. 7,910
• 117. weitzen 4 pts. 7,907
• 118. fryguy 4 pts. 7,906
• 119. Iron pet 4 pts. 7,899
• 120. JeNNeR 4 pts. 7,897