Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,311
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,215
  3. Avatar for Deleted group 13. Deleted group pts. 9,181
  4. Avatar for freefolder 14. freefolder 1 pt. 9,081
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,077
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 9,007
  7. Avatar for foldeRNA 17. foldeRNA 1 pt. 8,815
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,449
  9. Avatar for xkcd 19. xkcd 1 pt. 8,315
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,268

  1. Avatar for Pro Lapser 121. Pro Lapser Lv 1 3 pts. 8,983
  2. Avatar for pizpot 122. pizpot Lv 1 3 pts. 8,979
  3. Avatar for tela 123. tela Lv 1 3 pts. 8,978
  4. Avatar for MaartenDesnouck 124. MaartenDesnouck Lv 1 3 pts. 8,975
  5. Avatar for Merf 125. Merf Lv 1 2 pts. 8,957
  6. Avatar for sergiodana 126. sergiodana Lv 1 2 pts. 8,953
  7. Avatar for Superphosphate 127. Superphosphate Lv 1 2 pts. 8,946
  8. Avatar for ManVsYard 128. ManVsYard Lv 1 2 pts. 8,941
  9. Avatar for Exonx 129. Exonx Lv 1 2 pts. 8,940
  10. Avatar for Deleted player 130. Deleted player pts. 8,939

Comments