Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,311
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 2 pts. 9,215
  3. Avatar for Deleted group 13. Deleted group pts. 9,181
  4. Avatar for freefolder 14. freefolder 1 pt. 9,081
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,077
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 9,007
  7. Avatar for foldeRNA 17. foldeRNA 1 pt. 8,815
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,449
  9. Avatar for xkcd 19. xkcd 1 pt. 8,315
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,268

  1. Avatar for Andi1960 181. Andi1960 Lv 1 1 pt. 8,408
  2. Avatar for momadoc 182. momadoc Lv 1 1 pt. 8,403
  3. Avatar for franse 183. franse Lv 1 1 pt. 8,395
  4. Avatar for val.sch67 184. val.sch67 Lv 1 1 pt. 8,393
  5. Avatar for lukealo 185. lukealo Lv 1 1 pt. 8,393
  6. Avatar for wurzelwicht 186. wurzelwicht Lv 1 1 pt. 8,386
  7. Avatar for _undex 187. _undex Lv 1 1 pt. 8,384
  8. Avatar for mburns 188. mburns Lv 1 1 pt. 8,379
  9. Avatar for mastermatt7684 189. mastermatt7684 Lv 1 1 pt. 8,367
  10. Avatar for totalist 190. totalist Lv 1 1 pt. 8,340

Comments