Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for pmdpmd 91. pmdpmd Lv 1 9 pts. 9,101
  2. Avatar for HawkinsT 92. HawkinsT Lv 1 8 pts. 9,095
  3. Avatar for t012 93. t012 Lv 1 8 pts. 9,086
  4. Avatar for ecali 94. ecali Lv 1 8 pts. 9,083
  5. Avatar for Altercomp 95. Altercomp Lv 1 8 pts. 9,081
  6. Avatar for Mr_Jolty 96. Mr_Jolty Lv 1 7 pts. 9,077
  7. Avatar for isaksson 97. isaksson Lv 1 7 pts. 9,076
  8. Avatar for hansvandenhof 99. hansvandenhof Lv 1 7 pts. 9,075
  9. Avatar for PrettyPony2001 100. PrettyPony2001 Lv 1 6 pts. 9,074

Comments