Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for sharondipity 101. sharondipity Lv 1 6 pts. 9,071
  2. Avatar for hada 102. hada Lv 1 6 pts. 9,051
  3. Avatar for lilovip 103. lilovip Lv 1 6 pts. 9,048
  4. Avatar for Paulo Roque 104. Paulo Roque Lv 1 5 pts. 9,046
  5. Avatar for JUMELLE54 105. JUMELLE54 Lv 1 5 pts. 9,039
  6. Avatar for bamh 106. bamh Lv 1 5 pts. 9,032
  7. Avatar for shettler 107. shettler Lv 1 5 pts. 9,032
  8. Avatar for Soggy Doglog 108. Soggy Doglog Lv 1 5 pts. 9,031
  9. Avatar for Inkedhands 109. Inkedhands Lv 1 5 pts. 9,026
  10. Avatar for Mohambone 110. Mohambone Lv 1 4 pts. 9,023

Comments