Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for GenVeers 171. GenVeers Lv 1 1 pt. 8,518
  2. Avatar for lamoille 172. lamoille Lv 1 1 pt. 8,482
  3. Avatar for JackONeill12 173. JackONeill12 Lv 1 1 pt. 8,468
  4. Avatar for NotJim99 174. NotJim99 Lv 1 1 pt. 8,460
  5. Avatar for Savas 175. Savas Lv 1 1 pt. 8,449
  6. Avatar for nullenigma 176. nullenigma Lv 1 1 pt. 8,441
  7. Avatar for Crossed Sticks 177. Crossed Sticks Lv 1 1 pt. 8,428
  8. Avatar for tcortes 178. tcortes Lv 1 1 pt. 8,427
  9. Avatar for Jabba_ELE 179. Jabba_ELE Lv 1 1 pt. 8,414
  10. Avatar for Aldrovanda 180. Aldrovanda Lv 1 1 pt. 8,414

Comments