Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for Andi1960 181. Andi1960 Lv 1 1 pt. 8,408
  2. Avatar for momadoc 182. momadoc Lv 1 1 pt. 8,403
  3. Avatar for franse 183. franse Lv 1 1 pt. 8,395
  4. Avatar for val.sch67 184. val.sch67 Lv 1 1 pt. 8,393
  5. Avatar for lukealo 185. lukealo Lv 1 1 pt. 8,393
  6. Avatar for wurzelwicht 186. wurzelwicht Lv 1 1 pt. 8,386
  7. Avatar for _undex 187. _undex Lv 1 1 pt. 8,384
  8. Avatar for mburns 188. mburns Lv 1 1 pt. 8,379
  9. Avatar for mastermatt7684 189. mastermatt7684 Lv 1 1 pt. 8,367
  10. Avatar for totalist 190. totalist Lv 1 1 pt. 8,340

Comments