Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for Dominique Cs. 201. Dominique Cs. Lv 1 1 pt. 8,251
  2. Avatar for cnhrcolemam 202. cnhrcolemam Lv 1 1 pt. 8,240
  3. Avatar for smarthuman 203. smarthuman Lv 1 1 pt. 8,223
  4. Avatar for FreeFolder 204. FreeFolder Lv 1 1 pt. 8,202
  5. Avatar for Sonic Man1 205. Sonic Man1 Lv 1 1 pt. 8,188
  6. Avatar for trentis1 206. trentis1 Lv 1 1 pt. 8,187
  7. Avatar for Asclepius94 207. Asclepius94 Lv 1 1 pt. 8,182
  8. Avatar for brgreening 208. brgreening Lv 1 1 pt. 8,115
  9. Avatar for sambradley 209. sambradley Lv 1 1 pt. 8,105
  10. Avatar for Duke_K 210. Duke_K Lv 1 1 pt. 8,080

Comments