Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for joublot76 211. joublot76 Lv 1 1 pt. 8,078
  2. Avatar for VitorPresa 212. VitorPresa Lv 1 1 pt. 8,066
  3. Avatar for GreekCivilization 213. GreekCivilization Lv 1 1 pt. 8,063
  4. Avatar for zkm 214. zkm Lv 1 1 pt. 8,046
  5. Avatar for Tac1 215. Tac1 Lv 1 1 pt. 8,045
  6. Avatar for jatrick 216. jatrick Lv 1 1 pt. 7,950
  7. Avatar for COCOKHOCOK 217. COCOKHOCOK Lv 1 1 pt. 7,856
  8. Avatar for emdee314 218. emdee314 Lv 1 1 pt. 7,802
  9. Avatar for Close At Hand 219. Close At Hand Lv 1 1 pt. 7,454
  10. Avatar for fryguy 220. fryguy Lv 1 1 pt. 7,127

Comments