Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for bertro 21. bertro Lv 1 64 pts. 9,353
  2. Avatar for viosca 22. viosca Lv 1 62 pts. 9,352
  3. Avatar for egran48 23. egran48 Lv 1 61 pts. 9,350
  4. Avatar for WonkyDonkey 24. WonkyDonkey Lv 1 59 pts. 9,346
  5. Avatar for mimi 25. mimi Lv 1 58 pts. 9,346
  6. Avatar for Blipperman 26. Blipperman Lv 1 56 pts. 9,345
  7. Avatar for frood66 27. frood66 Lv 1 55 pts. 9,345
  8. Avatar for ponderosa 28. ponderosa Lv 1 54 pts. 9,341
  9. Avatar for O Seki To 29. O Seki To Lv 1 52 pts. 9,337
  10. Avatar for g_b 30. g_b Lv 1 51 pts. 9,335

Comments