Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for SKSbell 51. SKSbell Lv 1 30 pts. 9,256
  2. Avatar for jamiexq 52. jamiexq Lv 1 29 pts. 9,253
  3. Avatar for stomjoh 53. stomjoh Lv 1 28 pts. 9,253
  4. Avatar for dettingen 54. dettingen Lv 1 27 pts. 9,251
  5. Avatar for Museka 55. Museka Lv 1 26 pts. 9,250
  6. Avatar for dcrwheeler 56. dcrwheeler Lv 1 26 pts. 9,249
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 25 pts. 9,232
  8. Avatar for hpaege 58. hpaege Lv 1 24 pts. 9,227
  9. Avatar for nemo7731 59. nemo7731 Lv 1 24 pts. 9,225
  10. Avatar for christioanchauvin 60. christioanchauvin Lv 1 23 pts. 9,215

Comments