Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223

  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 22 pts. 9,215
  2. Avatar for Jim Fraser 62. Jim Fraser Lv 1 22 pts. 9,213
  3. Avatar for goastano 63. goastano Lv 1 21 pts. 9,213
  4. Avatar for Skippysk8s 64. Skippysk8s Lv 1 20 pts. 9,211
  5. Avatar for deLaCeiba 65. deLaCeiba Lv 1 20 pts. 9,209
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 19 pts. 9,205
  7. Avatar for leehaggis 67. leehaggis Lv 1 19 pts. 9,203
  8. Avatar for Satina 68. Satina Lv 1 18 pts. 9,203
  9. Avatar for marie.p 69. marie.p Lv 1 18 pts. 9,201
  10. Avatar for gurch 70. gurch Lv 1 17 pts. 9,193

Comments