Placeholder image of a protein
Icon representing a puzzle

1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
September 01, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,223
  1. Avatar for fishercat 81. fishercat Lv 1 12 pts. 9,150
  2. Avatar for sheerbliss 82. sheerbliss Lv 1 12 pts. 9,139
  3. Avatar for Festering Wounds 83. Festering Wounds Lv 1 11 pts. 9,134
  4. Avatar for Truncheon Luncheon 84. Truncheon Luncheon Lv 1 11 pts. 9,134
  5. Avatar for joremen 85. joremen Lv 1 11 pts. 9,134
  6. Avatar for foldit@bechan 86. foldit@bechan Lv 1 10 pts. 9,129
  7. Avatar for arginia 87. arginia Lv 1 10 pts. 9,128
  8. Avatar for Mydogisa Toelicker 88. Mydogisa Toelicker Lv 1 10 pts. 9,128
  9. Avatar for alwen 89. alwen Lv 1 9 pts. 9,127
  10. Avatar for Alistair69 90. Alistair69 Lv 1 9 pts. 9,105

Comments