1133: Revisiting Puzzle 89: Cow Eye

Closed since over 10 years ago

Summary

• Created: September 01, 2015
• Expires: September 08, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

• 1. Beta Folders 100 pts. 9,448
• 2. Contenders 78 pts. 9,438
• 3. Go Science 60 pts. 9,424
• 4. L'Alliance Francophone 45 pts. 9,421
• 5. Deleted group pts. 9,413
• 6. Anthropic Dreams 24 pts. 9,401
• 7. Gargleblasters 17 pts. 9,395
• 8. Void Crushers 12 pts. 9,386
• 9. HMT heritage 8 pts. 9,338
• 10. BOINC@Poland 6 pts. 9,322

Top soloists

• 31. diamond_dust 50 pts. 9,335
• 32. martin.szew 49 pts. 9,332
• 33. pvc78 47 pts. 9,332
• 34. cbwest 46 pts. 9,328
• 35. gloverd 45 pts. 9,326
• 36. kitek314_pl 44 pts. 9,322
• 37. gitwut 43 pts. 9,321
• 38. Idiotboy 42 pts. 9,320
• 39. Anfinsen_slept_here 41 pts. 9,319
• 40. reefyrob 40 pts. 9,316