Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415

  1. Avatar for BitSpawn
    1. BitSpawn Lv 1
    100 pts. 9,266
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 99 pts. 9,249
  3. Avatar for gmn 3. gmn Lv 1 97 pts. 9,229
  4. Avatar for LociOiling 4. LociOiling Lv 1 95 pts. 9,229
  5. Avatar for mimi 5. mimi Lv 1 94 pts. 9,221
  6. Avatar for Galaxie 6. Galaxie Lv 1 92 pts. 9,220
  7. Avatar for frood66 7. frood66 Lv 1 90 pts. 9,217
  8. Avatar for gitwut 8. gitwut Lv 1 89 pts. 9,208
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 87 pts. 9,207
  10. Avatar for johnmitch 10. johnmitch Lv 1 86 pts. 9,204

Comments