Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415

  1. Avatar for val.sch67 161. val.sch67 Lv 1 2 pts. 8,124
  2. Avatar for Altercomp 162. Altercomp Lv 1 2 pts. 8,109
  3. Avatar for Arne Heessels 163. Arne Heessels Lv 1 2 pts. 8,104
  4. Avatar for Jim Fraser 164. Jim Fraser Lv 1 2 pts. 8,070
  5. Avatar for adamsuperktos 165. adamsuperktos Lv 1 2 pts. 8,058
  6. Avatar for frostschutz 166. frostschutz Lv 1 2 pts. 8,029
  7. Avatar for SouperGenious 167. SouperGenious Lv 1 2 pts. 8,021
  8. Avatar for Schooman 168. Schooman Lv 1 2 pts. 7,988
  9. Avatar for martinf 169. martinf Lv 1 2 pts. 7,965
  10. Avatar for Space Goat 170. Space Goat Lv 1 2 pts. 7,963

Comments