Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415
  1. Avatar for Dr. Zach Fasig 191. Dr. Zach Fasig Lv 1 1 pt. 7,795
  2. Avatar for GenVeers 192. GenVeers Lv 1 1 pt. 7,783
  3. Avatar for vunop 193. vunop Lv 1 1 pt. 7,782
  4. Avatar for filiporlo 194. filiporlo Lv 1 1 pt. 7,778
  5. Avatar for JackONeill12 195. JackONeill12 Lv 1 1 pt. 7,765
  6. Avatar for xCl 196. xCl Lv 1 1 pt. 7,762
  7. Avatar for FMDJr 197. FMDJr Lv 1 1 pt. 7,759
  8. Avatar for twinsen92 198. twinsen92 Lv 1 1 pt. 7,741
  9. Avatar for katolikk 199. katolikk Lv 1 1 pt. 7,736
  10. Avatar for leomisso 200. leomisso Lv 1 1 pt. 7,712

Comments