Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415
  1. Avatar for cor2020 201. cor2020 Lv 1 1 pt. 7,709
  2. Avatar for NotJim99 202. NotJim99 Lv 1 1 pt. 7,708
  3. Avatar for inkycatz 203. inkycatz Lv 1 1 pt. 7,704
  4. Avatar for actin19 204. actin19 Lv 1 1 pt. 7,696
  5. Avatar for GooMat2015 205. GooMat2015 Lv 1 1 pt. 7,689
  6. Avatar for momadoc 206. momadoc Lv 1 1 pt. 7,687
  7. Avatar for Krzrz 207. Krzrz Lv 1 1 pt. 7,676
  8. Avatar for MisterEscape 208. MisterEscape Lv 1 1 pt. 7,671
  9. Avatar for EdzioWiertara 209. EdzioWiertara Lv 1 1 pt. 7,653
  10. Avatar for poiuyqwert 210. poiuyqwert Lv 1 1 pt. 7,651

Comments