Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415
  1. Avatar for Volken 221. Volken Lv 1 1 pt. 7,608
  2. Avatar for karost 222. karost Lv 1 1 pt. 7,602
  3. Avatar for Applemist 223. Applemist Lv 1 1 pt. 7,600
  4. Avatar for diagon369 224. diagon369 Lv 1 1 pt. 7,598
  5. Avatar for larry25427 225. larry25427 Lv 1 1 pt. 7,594
  6. Avatar for COCOKHOCOK 226. COCOKHOCOK Lv 1 1 pt. 7,580
  7. Avatar for Masterq 227. Masterq Lv 1 1 pt. 7,580
  8. Avatar for Udjine 228. Udjine Lv 1 1 pt. 7,564
  9. Avatar for Sigian 229. Sigian Lv 1 1 pt. 7,549
  10. Avatar for Ewelinka1992 230. Ewelinka1992 Lv 1 1 pt. 7,528

Comments