Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415
  1. Avatar for tpzcln 261. tpzcln Lv 1 1 pt. 7,115
  2. Avatar for lo1337a 262. lo1337a Lv 1 1 pt. 7,079
  3. Avatar for Piku91 263. Piku91 Lv 1 1 pt. 7,077
  4. Avatar for marcusrx1 264. marcusrx1 Lv 1 1 pt. 7,049
  5. Avatar for zkm 265. zkm Lv 1 1 pt. 6,842
  6. Avatar for ongis 266. ongis Lv 1 1 pt. 6,832
  7. Avatar for A_C 267. A_C Lv 1 1 pt. 6,669
  8. Avatar for dmcneill 268. dmcneill Lv 1 1 pt. 6,430
  9. Avatar for anjanimoola123 269. anjanimoola123 Lv 1 1 pt. 0
  10. Avatar for Thewarprider 270. Thewarprider Lv 1 1 pt. 0

Comments