Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 4 pts. 8,892
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 8,853
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 8,836
  4. Avatar for xkcd 14. xkcd 1 pt. 8,725
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,705
  6. Avatar for Deleted group 16. Deleted group pts. 8,167
  7. Avatar for freefolder 17. freefolder 1 pt. 8,109
  8. Avatar for Deleted group 18. Deleted group pts. 7,689
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,471
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,415

  1. Avatar for aznarog 21. aznarog Lv 1 70 pts. 9,154
  2. Avatar for Sissue 22. Sissue Lv 1 68 pts. 9,154
  3. Avatar for g_b 23. g_b Lv 1 67 pts. 9,148
  4. Avatar for egran48 24. egran48 Lv 1 66 pts. 9,140
  5. Avatar for mirp 25. mirp Lv 1 65 pts. 9,136
  6. Avatar for Deleted player 26. Deleted player pts. 9,132
  7. Avatar for bertro 27. bertro Lv 1 62 pts. 9,122
  8. Avatar for ponderosa 28. ponderosa Lv 1 61 pts. 9,114
  9. Avatar for actiasluna 29. actiasluna Lv 1 60 pts. 9,114
  10. Avatar for pmdpmd 30. pmdpmd Lv 1 59 pts. 9,112

Comments