Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Kramshaw's Genetics Class 21. Kramshaw's Genetics Class 1 pt. 7,138
  1. Avatar for BitSpawn
    1. BitSpawn Lv 1
    100 pts. 9,266
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 99 pts. 9,249
  3. Avatar for gmn 3. gmn Lv 1 97 pts. 9,229
  4. Avatar for LociOiling 4. LociOiling Lv 1 95 pts. 9,229
  5. Avatar for mimi 5. mimi Lv 1 94 pts. 9,221
  6. Avatar for Galaxie 6. Galaxie Lv 1 92 pts. 9,220
  7. Avatar for frood66 7. frood66 Lv 1 90 pts. 9,217
  8. Avatar for gitwut 8. gitwut Lv 1 89 pts. 9,208
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 87 pts. 9,207
  10. Avatar for johnmitch 10. johnmitch Lv 1 86 pts. 9,204

Comments