Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,266
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,249
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,231
  4. Avatar for Contenders 4. Contenders 45 pts. 9,221
  5. Avatar for Void Crushers 5. Void Crushers 33 pts. 9,207
  6. Avatar for Go Science 6. Go Science 24 pts. 9,202
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,188
  8. Avatar for Deleted group 8. Deleted group pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,107
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,037
  1. Avatar for Blipperman 21. Blipperman Lv 1 5 pts. 9,215
  2. Avatar for smholst 22. smholst Lv 1 4 pts. 9,206
  3. Avatar for gloverd 23. gloverd Lv 1 3 pts. 9,202
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 3 pts. 9,197
  5. Avatar for Paulo Roque 25. Paulo Roque Lv 1 2 pts. 9,197
  6. Avatar for mirp 26. mirp Lv 1 2 pts. 9,191
  7. Avatar for lamoille 27. lamoille Lv 1 1 pt. 9,163
  8. Avatar for ManVsYard 28. ManVsYard Lv 1 1 pt. 9,157
  9. Avatar for AryehK 29. AryehK Lv 1 1 pt. 9,156
  10. Avatar for ponderosa 30. ponderosa Lv 1 1 pt. 9,155

Comments