Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,266
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,249
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,231
  4. Avatar for Contenders 4. Contenders 45 pts. 9,221
  5. Avatar for Void Crushers 5. Void Crushers 33 pts. 9,207
  6. Avatar for Go Science 6. Go Science 24 pts. 9,202
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,188
  8. Avatar for Deleted group 8. Deleted group pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,107
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,037

  1. Avatar for aspadistra 241. aspadistra Lv 1 1 pt. 7,415
  2. Avatar for nekonekoneko 242. nekonekoneko Lv 1 1 pt. 7,410
  3. Avatar for cnhrcolemam 243. cnhrcolemam Lv 1 1 pt. 7,408
  4. Avatar for mistrzataku 244. mistrzataku Lv 1 1 pt. 7,406
  5. Avatar for E_Blake 245. E_Blake Lv 1 1 pt. 7,399
  6. Avatar for v_mulligan 246. v_mulligan Lv 1 1 pt. 7,398
  7. Avatar for Anairam 247. Anairam Lv 1 1 pt. 7,339
  8. Avatar for epicname 248. epicname Lv 1 1 pt. 7,325
  9. Avatar for Aldrovanda 249. Aldrovanda Lv 1 1 pt. 7,325
  10. Avatar for Jaco van As 250. Jaco van As Lv 1 1 pt. 7,320

Comments