Placeholder image of a protein
Icon representing a puzzle

1136: Revisiting Puzzle 90: Heliomicin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 07, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,266
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 9,249
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 9,231
  4. Avatar for Contenders 4. Contenders 45 pts. 9,221
  5. Avatar for Void Crushers 5. Void Crushers 33 pts. 9,207
  6. Avatar for Go Science 6. Go Science 24 pts. 9,202
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,188
  8. Avatar for Deleted group 8. Deleted group pts. 9,155
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,107
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 9,037

  1. Avatar for china_2272 251. china_2272 Lv 1 1 pt. 7,300
  2. Avatar for burnsng 252. burnsng Lv 1 1 pt. 7,291
  3. Avatar for Tretty B. 253. Tretty B. Lv 1 1 pt. 7,258
  4. Avatar for akpham 254. akpham Lv 1 1 pt. 7,255
  5. Avatar for BlaisePexyk 255. BlaisePexyk Lv 1 1 pt. 7,251
  6. Avatar for sahil117 256. sahil117 Lv 1 1 pt. 7,239
  7. Avatar for rkeith 257. rkeith Lv 1 1 pt. 7,218
  8. Avatar for gabriel_shaka 258. gabriel_shaka Lv 1 1 pt. 7,157
  9. Avatar for panKobra 259. panKobra Lv 1 1 pt. 7,146
  10. Avatar for DavidF_KRAM 260. DavidF_KRAM Lv 1 1 pt. 7,138

Comments