Placeholder image of a protein
Icon representing a puzzle

1142: Unsolved De-novo Freestyle 58

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 28, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 11 pts. 8,975
  2. Avatar for xkcd 12. xkcd 9 pts. 8,684
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 7 pts. 8,502
  4. Avatar for Androids 14. Androids 5 pts. 8,497
  5. Avatar for It's over 9000! 16. It's over 9000! 3 pts. 7,714
  6. Avatar for Deleted group 17. Deleted group pts. 7,129
  7. Avatar for freefolder 18. freefolder 1 pt. 6,996
  8. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 6,540
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 2,414

  1. Avatar for diamond_dust 31. diamond_dust Lv 1 59 pts. 9,319
  2. Avatar for gloverd 32. gloverd Lv 1 57 pts. 9,309
  3. Avatar for weitzen 33. weitzen Lv 1 56 pts. 9,308
  4. Avatar for Blipperman 34. Blipperman Lv 1 55 pts. 9,305
  5. Avatar for guineapig 35. guineapig Lv 1 54 pts. 9,299
  6. Avatar for nemo7731 36. nemo7731 Lv 1 53 pts. 9,282
  7. Avatar for Madde 37. Madde Lv 1 52 pts. 9,277
  8. Avatar for egran48 38. egran48 Lv 1 51 pts. 9,272
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 50 pts. 9,268
  10. Avatar for Vredeman 40. Vredeman Lv 1 49 pts. 9,267

Comments


Skippysk8s Lv 1

my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?

Bautho Lv 1

Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`

Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?

Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?

##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii