Skippysk8s Lv 1
my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?
Closed since over 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionThe structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?
opened a new client to save only. still not getting correct rankings or scores on this puzzzle
Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`
Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?
Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?
##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################
Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii
this may be too big for smaller machines….