Placeholder image of a protein
Icon representing a puzzle

1142: Unsolved De-novo Freestyle 58

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 28, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for CureCoin 21. CureCoin 1 pt. 1,073
  2. Avatar for Deleted group 22. Deleted group pts. 320
  3. Avatar for EVHS AP Biology 24. EVHS AP Biology 1 pt. 0
  4. Avatar for BCMB404-Fall2015 25. BCMB404-Fall2015 1 pt. 0
  5. Avatar for Alpha Folders 26. Alpha Folders 1 pt. 0
  6. Avatar for AP Physics 2 27. AP Physics 2 1 pt. 0
  7. Avatar for Minions of TWIS 28. Minions of TWIS 1 pt. 0
  8. Avatar for test_group1 29. test_group1 1 pt. 0

  1. Avatar for Oceanic86 231. Oceanic86 Lv 1 1 pt. 805
  2. Avatar for tryedward 232. tryedward Lv 1 1 pt. 422
  3. Avatar for korser2015 233. korser2015 Lv 1 1 pt. 320
  4. Avatar for cherry39 234. cherry39 Lv 1 1 pt. 283
  5. Avatar for Close At Hand 236. Close At Hand Lv 1 1 pt. 175
  6. Avatar for tomek1982m 238. tomek1982m Lv 1 1 pt. 0
  7. Avatar for zeemer007 239. zeemer007 Lv 1 1 pt. 0
  8. Avatar for chymiller0 240. chymiller0 Lv 1 1 pt. 0

Comments


Skippysk8s Lv 1

my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?

Bautho Lv 1

Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`

Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?

Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?

##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii