Placeholder image of a protein
Icon representing a puzzle

1142: Unsolved De-novo Freestyle 58

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 28, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,771
  2. Avatar for Go Science 2. Go Science 84 pts. 9,693
  3. Avatar for Beta Folders 3. Beta Folders 70 pts. 9,675
  4. Avatar for Contenders 4. Contenders 57 pts. 9,593
  5. Avatar for HMT heritage 5. HMT heritage 47 pts. 9,576
  6. Avatar for Void Crushers 6. Void Crushers 38 pts. 9,486
  7. Avatar for Deleted group 7. Deleted group pts. 9,435
  8. Avatar for Gargleblasters 8. Gargleblasters 24 pts. 9,388
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 19 pts. 9,367
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 15 pts. 9,264

  1. Avatar for criscris2 241. criscris2 Lv 1 1 pt. 0
  2. Avatar for amw11 243. amw11 Lv 1 1 pt. 0
  3. Avatar for hc819400 244. hc819400 Lv 1 1 pt. 0
  4. Avatar for spectre211 245. spectre211 Lv 1 1 pt. 0
  5. Avatar for opson93 247. opson93 Lv 1 1 pt. 0
  6. Avatar for Jflemming1 248. Jflemming1 Lv 1 1 pt. 0
  7. Avatar for Beauchat 249. Beauchat Lv 1 1 pt. 0
  8. Avatar for may of rose 250. may of rose Lv 1 1 pt. 0

Comments


Skippysk8s Lv 1

my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?

Bautho Lv 1

Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`

Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?

Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?

##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii