Placeholder image of a protein
Icon representing a puzzle

1142: Unsolved De-novo Freestyle 58

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 28, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,771
  2. Avatar for Go Science 2. Go Science 84 pts. 9,693
  3. Avatar for Beta Folders 3. Beta Folders 70 pts. 9,675
  4. Avatar for Contenders 4. Contenders 57 pts. 9,593
  5. Avatar for HMT heritage 5. HMT heritage 47 pts. 9,576
  6. Avatar for Void Crushers 6. Void Crushers 38 pts. 9,486
  7. Avatar for Deleted group 7. Deleted group pts. 9,435
  8. Avatar for Gargleblasters 8. Gargleblasters 24 pts. 9,388
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 19 pts. 9,367
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 15 pts. 9,264
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 48 pts. 9,264
  2. Avatar for aznarog 42. aznarog Lv 1 47 pts. 9,241
  3. Avatar for georg137 43. georg137 Lv 1 46 pts. 9,224
  4. Avatar for joremen 44. joremen Lv 1 45 pts. 9,224
  5. Avatar for proteansoup 45. proteansoup Lv 1 45 pts. 9,222
  6. Avatar for drumpeter18yrs9yrs 46. drumpeter18yrs9yrs Lv 1 44 pts. 9,214
  7. Avatar for reefyrob 47. reefyrob Lv 1 43 pts. 9,198
  8. Avatar for bertro 48. bertro Lv 1 42 pts. 9,186
  9. Avatar for Tweedle Dumb 49. Tweedle Dumb Lv 1 41 pts. 9,183
  10. Avatar for WarpSpeed 50. WarpSpeed Lv 1 40 pts. 9,181

Comments

Skippysk8s Lv 1

my scoreboard is totally different from what is showing up on my page and on the listings under this puzzle… others' scores also wrong
Is there a server problem with this puzzle?

Bautho Lv 1

Do you actually use a different score function for proteins that have a high content in hydrophobic amino acids like this protein?`

Since the sequence is predicted to have at least 4 or 5 transmembrane regions (see below, where the Ms show the membrane parts), do you distinguish between these hydrophobic parts and the soluble parts?

Or do you really want to solve the structure in solution (considering that this protein would not be stable in solution and rather form aggregates)?

##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2015-10-02 20:37:30
Total request time: 2.84 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 176 aa.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFL
DKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALV
ECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

OCTOPUS predicted membrane topology:
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooo
ooooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
MMMMMMMMMMMMMMMMMMMMMoMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiii