Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569
  1. Avatar for Birthday_Cakeman 181. Birthday_Cakeman Lv 1 1 pt. 7,137
  2. Avatar for pandabearsecond 182. pandabearsecond Lv 1 1 pt. 7,107
  3. Avatar for Socotra 183. Socotra Lv 1 1 pt. 7,082
  4. Avatar for pfeiffelfloyd 184. pfeiffelfloyd Lv 1 1 pt. 7,082
  5. Avatar for franse 185. franse Lv 1 1 pt. 7,063
  6. Avatar for JackONeill12 186. JackONeill12 Lv 1 1 pt. 7,042
  7. Avatar for TheFlagellum 187. TheFlagellum Lv 1 1 pt. 7,024
  8. Avatar for emdee314 188. emdee314 Lv 1 1 pt. 6,980
  9. Avatar for crackenmeister 189. crackenmeister Lv 1 1 pt. 6,975
  10. Avatar for Jim Fraser 190. Jim Fraser Lv 1 1 pt. 6,937

Comments