Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569
  1. Avatar for karost 191. karost Lv 1 1 pt. 6,929
  2. Avatar for martinf 192. martinf Lv 1 1 pt. 6,870
  3. Avatar for mmkkoop9 193. mmkkoop9 Lv 1 1 pt. 6,842
  4. Avatar for multaq 194. multaq Lv 1 1 pt. 6,828
  5. Avatar for roman madala 195. roman madala Lv 1 1 pt. 6,817
  6. Avatar for zzl 196. zzl Lv 1 1 pt. 6,803
  7. Avatar for SPARKSOFTHENILE 197. SPARKSOFTHENILE Lv 1 1 pt. 6,801
  8. Avatar for Shade0257 198. Shade0257 Lv 1 1 pt. 6,741
  9. Avatar for iankirk1098 199. iankirk1098 Lv 1 1 pt. 6,716
  10. Avatar for Emir Padilla 200. Emir Padilla Lv 1 1 pt. 6,701

Comments