Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569
  1. Avatar for cassandraberry81897 251. cassandraberry81897 Lv 1 1 pt. 0
  2. Avatar for jermainiac 252. jermainiac Lv 1 1 pt. 0
  3. Avatar for agnairt 253. agnairt Lv 1 1 pt. 0
  4. Avatar for packer 254. packer Lv 1 1 pt. 0
  5. Avatar for andreysams 255. andreysams Lv 1 1 pt. 0
  6. Avatar for Antibrad 256. Antibrad Lv 1 1 pt. 0
  7. Avatar for clunneyonw 257. clunneyonw Lv 1 1 pt. 0
  8. Avatar for val.sch67 258. val.sch67 Lv 1 1 pt. 0
  9. Avatar for snft 259. snft Lv 1 1 pt. 0

Comments