Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569

  1. Avatar for Satina 41. Satina Lv 1 44 pts. 9,136
  2. Avatar for Paulo Roque 42. Paulo Roque Lv 1 43 pts. 9,130
  3. Avatar for g_b 43. g_b Lv 1 42 pts. 9,130
  4. Avatar for hansvandenhof 44. hansvandenhof Lv 1 41 pts. 9,128
  5. Avatar for christioanchauvin 45. christioanchauvin Lv 1 40 pts. 9,117
  6. Avatar for cobaltteal 46. cobaltteal Lv 1 39 pts. 9,112
  7. Avatar for pmthomson90 47. pmthomson90 Lv 1 38 pts. 9,107
  8. Avatar for DodoBird 48. DodoBird Lv 1 37 pts. 9,083
  9. Avatar for joremen 49. joremen Lv 1 36 pts. 9,080
  10. Avatar for WarpSpeed 50. WarpSpeed Lv 1 35 pts. 9,074

Comments