Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,107
  2. Avatar for BOINC@Poland 12. BOINC@Poland 7 pts. 8,803
  3. Avatar for xkcd 13. xkcd 5 pts. 8,564
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,148
  5. Avatar for Androids 15. Androids 3 pts. 7,710
  6. Avatar for Deleted group 16. Deleted group pts. 7,672
  7. Avatar for Rice Biochemistry 17. Rice Biochemistry 1 pt. 7,643
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 7,444
  9. Avatar for freefolder 19. freefolder 1 pt. 7,387
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,569

  1. Avatar for TomTaylor 81. TomTaylor Lv 1 16 pts. 8,786
  2. Avatar for nemo7731 82. nemo7731 Lv 1 16 pts. 8,782
  3. Avatar for bendbob 83. bendbob Lv 1 15 pts. 8,768
  4. Avatar for tallguy-13088 84. tallguy-13088 Lv 1 15 pts. 8,764
  5. Avatar for andrewxc 85. andrewxc Lv 1 14 pts. 8,749
  6. Avatar for jamiexq 86. jamiexq Lv 1 14 pts. 8,729
  7. Avatar for Idiotboy 87. Idiotboy Lv 1 14 pts. 8,693
  8. Avatar for YeshuaLives 88. YeshuaLives Lv 1 13 pts. 8,656
  9. Avatar for pfirth 89. pfirth Lv 1 13 pts. 8,631
  10. Avatar for phi16 90. phi16 Lv 1 13 pts. 8,630

Comments