Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,356
  2. Avatar for EVHS AP Biology 22. EVHS AP Biology 1 pt. 6,236
  3. Avatar for Deleted group 23. Deleted group pts. 6,211
  4. Avatar for Deleted group 24. Deleted group pts. 6,098
  5. Avatar for CureCoin 25. CureCoin 1 pt. 6,025
  6. Avatar for LS Pro Folders 26. LS Pro Folders 1 pt. 6,025
  7. Avatar for Deleted group 27. Deleted group pts. 5,907
  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 9,351
  2. Avatar for bertro 2. bertro Lv 1 99 pts. 9,347
  3. Avatar for reefyrob 3. reefyrob Lv 1 97 pts. 9,343
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 95 pts. 9,306
  5. Avatar for gmn 5. gmn Lv 1 93 pts. 9,299
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 91 pts. 9,295
  7. Avatar for aznarog 7. aznarog Lv 1 89 pts. 9,291
  8. Avatar for nicobul 8. nicobul Lv 1 88 pts. 9,291
  9. Avatar for gitwut 9. gitwut Lv 1 86 pts. 9,285
  10. Avatar for pauldunn 10. pauldunn Lv 1 84 pts. 9,283

Comments