Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218
  1. Avatar for actiasluna 21. actiasluna Lv 1 5 pts. 9,295
  2. Avatar for MaartenDesnouck 22. MaartenDesnouck Lv 1 4 pts. 9,295
  3. Avatar for Norrjane 23. Norrjane Lv 1 3 pts. 9,294
  4. Avatar for gloverd 24. gloverd Lv 1 3 pts. 9,294
  5. Avatar for jermainiac 25. jermainiac Lv 1 2 pts. 9,291
  6. Avatar for alwen 26. alwen Lv 1 2 pts. 9,291
  7. Avatar for lamoille 27. lamoille Lv 1 1 pt. 9,290
  8. Avatar for egran48 28. egran48 Lv 1 1 pt. 9,289
  9. Avatar for diamond_dust 29. diamond_dust Lv 1 1 pt. 9,286
  10. Avatar for mirp 30. mirp Lv 1 1 pt. 9,284

Comments