Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Go Science 100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218

  1. Avatar for tryedward 231. tryedward Lv 1 1 pt. 5,983
  2. Avatar for Blitzghost 232. Blitzghost Lv 1 1 pt. 5,955
  3. Avatar for Jaco van As 233. Jaco van As Lv 1 1 pt. 5,950
  4. Avatar for COCOKHOCOK 235. COCOKHOCOK Lv 1 1 pt. 5,759
  5. Avatar for mbassford 236. mbassford Lv 1 1 pt. 5,721
  6. Avatar for jacky9691 237. jacky9691 Lv 1 1 pt. 5,683
  7. Avatar for wjvanpatten 238. wjvanpatten Lv 1 1 pt. 5,639
  8. Avatar for Zhi 239. Zhi Lv 1 1 pt. 5,632
  9. Avatar for alcor29 240. alcor29 Lv 1 1 pt. 5,530

Comments