Placeholder image of a protein
Icon representing a puzzle

1143: Revisiting Puzzle 93: Spider Toxin

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 30, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Go Science 100 pts. 9,356
  2. Avatar for Beta Folders 2. Beta Folders 83 pts. 9,348
  3. Avatar for Void Crushers 3. Void Crushers 68 pts. 9,306
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 55 pts. 9,305
  5. Avatar for Gargleblasters 5. Gargleblasters 44 pts. 9,297
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 35 pts. 9,291
  7. Avatar for Contenders 7. Contenders 27 pts. 9,285
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 21 pts. 9,283
  9. Avatar for Deleted group 9. Deleted group pts. 9,236
  10. Avatar for HMT heritage 10. HMT heritage 12 pts. 9,218

  1. Avatar for alwen 71. alwen Lv 1 21 pts. 8,826
  2. Avatar for guineapig 72. guineapig Lv 1 21 pts. 8,809
  3. Avatar for isaksson 73. isaksson Lv 1 20 pts. 8,804
  4. Avatar for kitek314_pl 74. kitek314_pl Lv 1 19 pts. 8,803
  5. Avatar for deLaCeiba 75. deLaCeiba Lv 1 19 pts. 8,802
  6. Avatar for caglar 76. caglar Lv 1 18 pts. 8,802
  7. Avatar for Cyberkashi 77. Cyberkashi Lv 1 18 pts. 8,799
  8. Avatar for dettingen 78. dettingen Lv 1 17 pts. 8,794
  9. Avatar for diamond_dust 79. diamond_dust Lv 1 17 pts. 8,794
  10. Avatar for stomjoh 80. stomjoh Lv 1 17 pts. 8,790

Comments