spvincent Lv 1
Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?
1145: Unsolved De-novo Freestyle 58: Cell Membrane
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- October 05, 2015
- Expires
- Max points
- 100
This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.
Sequence:
EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR
Top groups
Comments
Susume Lv 1
It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.