Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 13,962
  2. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 13,642
  3. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 13,161
  4. Avatar for xkcd 15. xkcd 1 pt. 12,962
  5. Avatar for Deleted group 16. Deleted group pts. 12,872
  6. Avatar for freefolder 17. freefolder 1 pt. 11,896
  7. Avatar for Rice Biochemistry 18. Rice Biochemistry 1 pt. 10,761
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 57 pts. 14,361
  2. Avatar for nicobul 32. nicobul Lv 1 55 pts. 14,355
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 54 pts. 14,340
  4. Avatar for shettler 34. shettler Lv 1 53 pts. 14,332
  5. Avatar for egran48 35. egran48 Lv 1 52 pts. 14,331
  6. Avatar for nemo7731 36. nemo7731 Lv 1 51 pts. 14,323
  7. Avatar for mirp 37. mirp Lv 1 50 pts. 14,316
  8. Avatar for WarpSpeed 38. WarpSpeed Lv 1 49 pts. 14,306
  9. Avatar for O Seki To 39. O Seki To Lv 1 48 pts. 14,292
  10. Avatar for georg137 40. georg137 Lv 1 47 pts. 14,282

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.