Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups

  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 0
  1. Avatar for unknownghostscientist 221. unknownghostscientist Lv 1 1 pt. 8,451
  2. Avatar for zkm 222. zkm Lv 1 1 pt. 8,417
  3. Avatar for anthony63 223. anthony63 Lv 1 1 pt. 8,414
  4. Avatar for NotJim99 224. NotJim99 Lv 1 1 pt. 8,405
  5. Avatar for 8hatah8 225. 8hatah8 Lv 1 1 pt. 8,308
  6. Avatar for wallr1 226. wallr1 Lv 1 1 pt. 8,307
  7. Avatar for futairan 227. futairan Lv 1 1 pt. 8,268
  8. Avatar for MaartenDesnouck 228. MaartenDesnouck Lv 1 1 pt. 8,254
  9. Avatar for LuciferLaw 229. LuciferLaw Lv 1 1 pt. 8,210
  10. Avatar for DLD104 230. DLD104 Lv 1 1 pt. 7,628

Comments

spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.