Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 0

  1. Avatar for diamond_dust 51. diamond_dust Lv 1 37 pts. 14,185
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 36 pts. 14,173
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 35 pts. 14,167
  4. Avatar for gloverd 54. gloverd Lv 1 35 pts. 14,153
  5. Avatar for t012 55. t012 Lv 1 34 pts. 14,138
  6. Avatar for jamiexq 56. jamiexq Lv 1 33 pts. 14,134
  7. Avatar for silverberg 57. silverberg Lv 1 32 pts. 14,132
  8. Avatar for isaksson 58. isaksson Lv 1 32 pts. 14,129
  9. Avatar for Merf 59. Merf Lv 1 31 pts. 14,128
  10. Avatar for g_b 60. g_b Lv 1 30 pts. 14,119

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.