Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for BCMB404-Fall2015 21. BCMB404-Fall2015 1 pt. 0

  1. Avatar for gurch 81. gurch Lv 1 18 pts. 13,882
  2. Avatar for Iron pet 82. Iron pet Lv 1 18 pts. 13,859
  3. Avatar for tarimo 83. tarimo Lv 1 17 pts. 13,854
  4. Avatar for Museka 84. Museka Lv 1 17 pts. 13,851
  5. Avatar for jobo0502 85. jobo0502 Lv 1 17 pts. 13,850
  6. Avatar for ecali 86. ecali Lv 1 16 pts. 13,842
  7. Avatar for guineapig 87. guineapig Lv 1 16 pts. 13,832
  8. Avatar for WonkyDonkey 88. WonkyDonkey Lv 1 15 pts. 13,827
  9. Avatar for Tweedle Dumb 89. Tweedle Dumb Lv 1 15 pts. 13,823
  10. Avatar for fishercat 90. fishercat Lv 1 15 pts. 13,818

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.