Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,729
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 14,702
  3. Avatar for Contenders 3. Contenders 60 pts. 14,600
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 14,594
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 14,592
  6. Avatar for Go Science 6. Go Science 24 pts. 14,581
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 14,468
  8. Avatar for Deleted group 8. Deleted group pts. 14,437
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 14,292
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 14,249

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 36 pts. 14,607
  2. Avatar for Deleted player 12. Deleted player pts. 14,597
  3. Avatar for gitwut 13. gitwut Lv 1 29 pts. 14,596
  4. Avatar for Blipperman 14. Blipperman Lv 1 26 pts. 14,594
  5. Avatar for hansvandenhof 15. hansvandenhof Lv 1 23 pts. 14,594
  6. Avatar for actiasluna 16. actiasluna Lv 1 20 pts. 14,589
  7. Avatar for mimi 17. mimi Lv 1 18 pts. 14,585
  8. Avatar for spvincent 18. spvincent Lv 1 16 pts. 14,581
  9. Avatar for gloverd 19. gloverd Lv 1 14 pts. 14,578
  10. Avatar for Paulo Roque 20. Paulo Roque Lv 1 12 pts. 14,577

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.