Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,729
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 14,702
  3. Avatar for Contenders 3. Contenders 60 pts. 14,600
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 14,594
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 14,592
  6. Avatar for Go Science 6. Go Science 24 pts. 14,581
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 14,468
  8. Avatar for Deleted group 8. Deleted group pts. 14,437
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 14,292
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 14,249

  1. Avatar for brow42 111. brow42 Lv 1 8 pts. 13,546
  2. Avatar for NameChangeNeeded01 112. NameChangeNeeded01 Lv 1 8 pts. 13,540
  3. Avatar for martinf 113. martinf Lv 1 8 pts. 13,526
  4. Avatar for tela 114. tela Lv 1 8 pts. 13,517
  5. Avatar for Mark A 115. Mark A Lv 1 7 pts. 13,508
  6. Avatar for Inkedhands 116. Inkedhands Lv 1 7 pts. 13,495
  7. Avatar for Truncheon Luncheon 117. Truncheon Luncheon Lv 1 7 pts. 13,483
  8. Avatar for marie.p 118. marie.p Lv 1 7 pts. 13,476
  9. Avatar for TJOK fan 119. TJOK fan Lv 1 6 pts. 13,467
  10. Avatar for Reuben 120. Reuben Lv 1 6 pts. 13,456

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.