Placeholder image of a protein
Icon representing a puzzle

1145: Unsolved De-novo Freestyle 58: Cell Membrane

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
October 05, 2015
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1142, now with a slightly modified score function. This protein is predicted to be a membrane protein; instead of dissolving in the watery environment of the cytoplasm, this protein resides in the oily environment of the cell membrane. Unlike proteins of typical Foldit puzzles, this protein is likely to have more hydrophobic (orange) residues on the surface, with polar (blue) residues making hydrogen bonds in the protein core. Players will be able to load in manual saves from Puzzle 1142 and use them as a starting point here.



Sequence:


EDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 14,729
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 14,702
  3. Avatar for Contenders 3. Contenders 60 pts. 14,600
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 14,594
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 14,592
  6. Avatar for Go Science 6. Go Science 24 pts. 14,581
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 14,468
  8. Avatar for Deleted group 8. Deleted group pts. 14,437
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 14,292
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 14,249

  1. Avatar for powerjoris 261. powerjoris Lv 1 1 pt. 0
  2. Avatar for multaq 262. multaq Lv 1 1 pt. 0
  3. Avatar for szymon1051 263. szymon1051 Lv 1 1 pt. 0
  4. Avatar for TSTL 264. TSTL Lv 1 1 pt. 0
  5. Avatar for Mlevanic 265. Mlevanic Lv 1 1 pt. 0
  6. Avatar for greepski 266. greepski Lv 1 1 pt. 0
  7. Avatar for decbin 267. decbin Lv 1 1 pt. 0
  8. Avatar for Lepidus 269. Lepidus Lv 1 1 pt. 0
  9. Avatar for xcrv2000 270. xcrv2000 Lv 1 1 pt. 0

Comments


spvincent Lv 1

Some bits like the C-terminus look as if they're all hydrophilic: perhaps these areas would lie inside or outside the cell?

Susume Lv 1

It would be cool to have a higher weight given to the bonding score in this puzzle to encourage sidechain bonds in the interior. Since most of the protein is helices, most of the possible backbone bonds are already made, so increases in bonding score could be assumed to come largely from sidechain bonds. Or the new Hbond network filter could be used to encourage bonds in the interior.