Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,784
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,740
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,593
  4. Avatar for Deleted group 14. Deleted group pts. 8,578
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,484
  6. Avatar for Russian team 16. Russian team 1 pt. 8,271
  7. Avatar for SHELL 17. SHELL 1 pt. 8,169
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,821
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,739
  10. Avatar for freefolder 20. freefolder 1 pt. 7,175
  1. Avatar for hpaege
    1. hpaege Lv 1
    100 pts. 9,152
  2. Avatar for BitSpawn 2. BitSpawn Lv 1 98 pts. 9,143
  3. Avatar for johnmitch 3. johnmitch Lv 1 97 pts. 9,092
  4. Avatar for frood66 4. frood66 Lv 1 95 pts. 9,080
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 93 pts. 9,071
  6. Avatar for pauldunn 6. pauldunn Lv 1 91 pts. 9,059
  7. Avatar for O Seki To 7. O Seki To Lv 1 89 pts. 9,050
  8. Avatar for bertro 8. bertro Lv 1 87 pts. 9,042
  9. Avatar for LociOiling 9. LociOiling Lv 1 85 pts. 9,037
  10. Avatar for mirp 10. mirp Lv 1 83 pts. 9,023

Comments