Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,784
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 5 pts. 8,740
  3. Avatar for BOINC@Poland 13. BOINC@Poland 4 pts. 8,593
  4. Avatar for Deleted group 14. Deleted group pts. 8,578
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,484
  6. Avatar for Russian team 16. Russian team 1 pt. 8,271
  7. Avatar for SHELL 17. SHELL 1 pt. 8,169
  8. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,821
  9. Avatar for Minions of TWIS 19. Minions of TWIS 1 pt. 7,739
  10. Avatar for freefolder 20. freefolder 1 pt. 7,175
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,197
  2. Avatar for gloverd 2. gloverd Lv 1 90 pts. 9,196
  3. Avatar for diamond_dust 3. diamond_dust Lv 1 81 pts. 9,194
  4. Avatar for Paulo Roque 4. Paulo Roque Lv 1 72 pts. 9,193
  5. Avatar for pauldunn 5. pauldunn Lv 1 64 pts. 9,188
  6. Avatar for mirp 6. mirp Lv 1 57 pts. 9,180
  7. Avatar for Galaxie 7. Galaxie Lv 1 50 pts. 9,160
  8. Avatar for KarenCH 8. KarenCH Lv 1 44 pts. 9,149
  9. Avatar for BitSpawn 9. BitSpawn Lv 1 39 pts. 9,143
  10. Avatar for MaartenDesnouck 10. MaartenDesnouck Lv 1 34 pts. 9,139

Comments